PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14656.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 330aa    MW: 37110.5 Da    PI: 4.927
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14656.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd++l d++++ G g+Wkt ++  g+ R++k+c++rw +yl
       KHN14656.1 14 KGRWTAEEDKILTDYIQENGEGSWKTLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.92e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+e++v++++ lG++ W+ Ia +++ gRt++++k++w+++l
       KHN14656.1  67 RGNITPEEEEIIVKLHAVLGNR-WSVIAGRLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.373961IPR017930Myb domain
SuperFamilySSF466891.46E-2811108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002496.7E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-211568IPR009057Homeodomain-like
CDDcd001672.94E-91661No hitNo description
PROSITE profilePS5129425.75562116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002495.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2569116IPR009057Homeodomain-like
CDDcd001672.86E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGRWTAE EDKILTDYIQ ENGEGSWKTL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI TPEEEEIIVK LHAVLGNRWS VIAGRLPGRT DNEIKNYWNS HLRRKIYCFM  120
RSLNESLPPT DMAAVNSATS KRRVRGSRNK PATEEEKNMA LSQNSFESMP SCNREEGEEI  180
SMMDACYEME SITISSTFAS CPSLEASLGP YHHWSDDEIM KLGNMFENGV LVNPSGNNVT  240
LKDEPNGIEC GQMNVDIMGT DQSKNNASNG DSGEWYPNCS SVNSAIDYQW SDWDMGGSVQ  300
SNNQWNLCDD QVMNCLWSTG IGEINYGFHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547366.10.0PREDICTED: transcription repressor MYB6-like
SwissprotO222641e-71MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0B2PZA70.0A0A0B2PZA7_GLYSO; Transcription factor MYB12
STRINGGLYMA15G15400.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.15e-75myb domain protein 111
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]